PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla019144
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family MYB
Protein Properties Length: 373aa    MW: 42267.4 Da    PI: 6.6473
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla019144genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.94.1e-121461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd + +  v ++G+ +W++ +++ g++R++k+c++r  +yl
        Cla019144 14 RGLWTAEEDAKVLAHVSKHGTSNWTSAPKKAGLRRCGKSCRLRRTNYL 61
                     788****************************************98886 PP

2Myb_DNA-binding44.43.9e-1469110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T +E+el++++++  G++ W+ Ia+ ++ gRt++++k++w++
        Cla019144  69 NFTSQEEELIIRLHAAIGSR-WAIIAQQLP-GRTDNDVKNYWNT 110
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-18664IPR009057Homeodomain-like
PROSITE profilePS5129413.435961IPR017930Myb domain
SuperFamilySSF466891.01E-2511108IPR009057Homeodomain-like
SMARTSM007179.5E-81363IPR001005SANT/Myb domain
PfamPF002492.9E-101461IPR001005SANT/Myb domain
CDDcd001672.07E-61761No hitNo description
PROSITE profilePS5129422.27362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.2E-2365116IPR009057Homeodomain-like
SMARTSM007174.7E-1366114IPR001005SANT/Myb domain
PfamPF002498.8E-1369110IPR001005SANT/Myb domain
CDDcd001671.87E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MVRIPSCDKL NLKRGLWTAE EDAKVLAHVS KHGTSNWTSA PKKAGLRRCG KSCRLRRTNY  60
LRPDLKHHNF TSQEEELIIR LHAAIGSRWA IIAQQLPGRT DNDVKNYWNT KLRRKLSEMG  120
IDPVTHKPFS QILADYGNIS GLPRSTKRIG SLSRDLKTSA YMKPEHYSNS AQGLFKGIDV  180
DLSTPSLLLP ETEPVMNKFM NGNVHQLNNN NSLNLLAQLQ AMQLVTEASY CTVNEQIQPN  240
FYAQGYLPSS SSSSSSSTTT ATYRHSSSAF SWQDFLLEDA FLPSELPREH ENVAEFPVNQ  300
TACQAENGIS KEEMNKEISD YQYNRFEAMH CLAENNDIET SSSAENTFIE TLLHQEDKIL  360
VDFLNLLEEP LYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26111164108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453162.10.0PREDICTED: transcription factor MYB24-like
TrEMBLA0A0A0LP090.0A0A0A0LP09_CUCSA; Uncharacterized protein
STRINGPOPTR_0015s07900.11e-129(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.16e-68MYB family protein